Protein Info for Atu3076 in Agrobacterium fabrum C58

Annotation: uracil transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 391 to 405 (15 residues), see Phobius details amino acids 407 to 407 (1 residues), see Phobius details amino acids 409 to 433 (25 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 24 to 426 (403 residues), 340 bits, see alignment E=1e-105 PF00860: Xan_ur_permease" amino acids 28 to 407 (380 residues), 301.1 bits, see alignment E=5.2e-94

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3076)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRJ1 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Atu3076 uracil transport protein (Agrobacterium fabrum C58)
MSDTGGYFPRWRLKTEGRIMPDERLPAGQTAVLGLQHVVAMFGSTVLAPLIMGFDPNVSI
LFSGISTLIFFIAVGGRVPSYLGSSFAFIGPVLVATGAAAGAASPDIALALGGIIAAGVL
YALIGVIVMIVGHNWIEKLMPPVLTGAIVAAIGLVLAPIAIASASGTGPGNPDGDQLSRW
IAILTVTSVGAIAVYAPGMTRRLPILLGGAIAYLAYLVLANGFGLGKPVDFAGVAAAAWF
GLPAFTTPVFSAPAIALIAPVVVILVAENLGHIKAIGAMTGRNLDPYLGRAFIGDGIATI
FSGAFGGTGMTTYAENMGVMAITRIFSTLVFIVAALVAIILGFSPKFGALIQTIPGPVIG
GLSVVVFGLIAATAGRIWVENKVDFSEPRNLITVGIALVLGAGNFKLNVAGFTLDGIGTA
TIGAIAFYHLLGLGRPAQGR