Protein Info for Atu3056 in Agrobacterium fabrum C58

Annotation: beta 1,3 glucan synthase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 518 to 539 (22 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 120 to 345 (226 residues), 72.6 bits, see alignment E=1.2e-23 PF00535: Glycos_transf_2" amino acids 122 to 291 (170 residues), 59.1 bits, see alignment E=1.3e-19 PF13506: Glyco_transf_21" amino acids 199 to 344 (146 residues), 43.3 bits, see alignment E=7.1e-15 PF13632: Glyco_trans_2_3" amino acids 203 to 408 (206 residues), 85.3 bits, see alignment E=1.3e-27

Best Hits

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 100% identity to atu:Atu3056)

Predicted SEED Role

"Cellulose synthase (UDP-forming) (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.12

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEL4 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Atu3056 beta 1,3 glucan synthase catalytic subunit (Agrobacterium fabrum C58)
MYFSAEGDVQSVLYVNLTIAIGAILFALLADPRKMVDRLAFSIIMLLSLGVYIVWRATDT
LPPLEFSLETLWCYTYFTFELISVLYAMGSILILLRRTDWSAVADQGEAYLAGNPHAPLV
DVFICTYNEPLNVLEKSIIAAQAMDYPRLRVFVCDDTRRAEVRTYCEAVGVNYVTRPDNK
HAKAGNLNNALLHTNALEEVSDFIMVLDADFAPQANFLRRVTGLFSDPKVAVVQTPQFYF
NSDPIQHNLGIDKSFVDDQRVFFDVFQPAKDAVGCAFCVGTSFVVRRAAVNGIGGFPSDA
LSEDMLLTYRLMERGYVTRWLNEKLSVGLSAEGVPEYITQRTRWCLGTIQIGLLRTGPLW
RGNFTLTQRLHYLHGLFCWLSKPFILCLLLAPSIYWLTGVSALQADELMFMKLGLSSLAL
FWTYSTWISGKRTLPLFTEVTHALTAVPITITLFQAIRKPFGRPFKVTEKGGDRSQVRVH
LPTAIFFAFVTLSSAVSIVLAVYGLDAPSELSSRDCLNLIWSAVAMVIAFTSFICCIELP
RFGKEEMIGVDFRGQLRSASSTRPVRITGLSTENITLAAVPSSSDVTDVFVPEAGWMRIS
PAEHAQNSGKFDIHPSDEQRRSILRLLFRKAPENVAEQGDLMKSMRILLARAFG