Protein Info for Atu3048 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 283 to 309 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 89 (89 residues), 42.8 bits, see alignment E=5.6e-15 PF00528: BPD_transp_1" amino acids 114 to 314 (201 residues), 127.4 bits, see alignment E=5.5e-41

Best Hits

Swiss-Prot: 42% identical to APPB_BACSU: Oligopeptide transport system permease protein AppB (appB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3048)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEL2 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Atu3048 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MLTFLLHRIWQSLVLLLLVSIIGFAILNLAPGGPLSQFALTPGMTREALDRIAHQMGLDR
PLPIQYLDWAWRLLQGDWGKSYRDQRPVLDIISGHLFATLLLMVSSTVVSVLVGTWIGIK
GAIKRYTLFDYTATVGAMIALSIPTFWFGLVAIYVFALRLKWLPAGNMYTIGDQSLYDYA
IHLIMPSLVLALVNIAVWSRYMRTATLDVINQDFVRTARAKGLTPRRVLMKHVVGNALLP
MITLAGLQLPTILGGALVTETVFTWPGMGRLFLDSLGYHDYPVVMGLLMFSAILVLFGSL
LADLLVALVDPRIRLG