Protein Info for Atu3036 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 263 to 289 (27 residues), see Phobius details amino acids 307 to 332 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 9 to 79 (71 residues), 48 bits, see alignment E=1.3e-16 PF00528: BPD_transp_1" amino acids 117 to 338 (222 residues), 118.1 bits, see alignment E=3.8e-38

Best Hits

Swiss-Prot: 36% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3036)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRF2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu3036 dipeptide ABC transporter permease (Agrobacterium fabrum C58)
MQQHPLVAILNRLGAFVLVMIALSIMIFALARVVPGDPARMALGPAATQEQVDALRGEMG
LDKPLAVQYLDYIGNALHGDLGFSLVSQRPVTTDLAQTVPATVELVLVSVIFMFAVAIPL
GVITAHYRDRPLDHIGRILSLTGVTIPSFLFAITLQLLAARFLSGWPIIGRLDHGLGWQG
GPTGFILIDGTLAGRFDVVLDALKHLALPAFALSMAGIGQITRITRSSMIENQRKDHVLT
LQSFGVPERVIIFRYLLKLSSIAPLTIMGLEFASLIGNAFVIEMVFAWGGFASYGLNAIL
QKDLNAVTAVVLVAGLFFIVANLIVDVLISIIDPRLRRKEAR