Protein Info for Atu3029 in Agrobacterium fabrum C58

Annotation: glucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 31 to 130 (100 residues), 23.8 bits, E=4.4e-09
• PF13378: MR_MLE_C
  • amino acids 167 to 378 (212 residues), 188.1 bits, E=1.8e-59

Best Hits

KEGG orthology group: K01706, glucarate dehydratase [EC: 4.2.1.40] (inferred from 100% identity to atu:Atu3029)

Predicted SEED Role

No annotation

MetaCyc Pathways

• D-glucarate degradation II (3/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (22/31 steps found)
• superpathway of D-glucarate and D-galactarate degradation (3/5 steps found)
• D-glucarate degradation I (2/4 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.40

Sequence Analysis Tools

See Q7CRE5 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Atu3029 glucarate dehydratase (Agrobacterium fabrum C58)
MRIAEIHLTPVAIPDRPLLNCKGVHQPHALRTVIEVICDDGTVGLGESYGSIKALEGLRR
AAPALIGLDPFHLHELKSRIIAALPGGGGINAKSAVADHKLTDVVASAFEVPCLDIQGKL
LGRPVCDLLGGAVRTSVPFSAYLFFKFAGHIGEAPDEWGEVLTPDQMVGEARRMVENHGF
QSLKLKGGVLHPDLEIETMLKLREAFPRHPLRIDPNGGWTVETAIHVARKLENVLEYLED
PVLGMDQMAQVAAATSIPLATNMVVLEFDHIAAAFEKKAVKIVLSDHHYWGGLRAASHLS
KICEVLDLGLSMHSNSHLGITLAAMVHAAAATPNLTFDCDTHYPWTATDVIEGTPFIFRD
GKLALPTKPGLGVSLDRNKLASLAALYDESSLKERDDTAYMKLFDPDYTRRVPRW