Protein Info for Atu3009 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 3 to 319 (317 residues), 104.3 bits, see alignment E=3.5e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3009)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEI9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Atu3009 exopolysaccharide production protein (Agrobacterium fabrum C58)
MIINLQALRAVAAFLVFFHHFLPYVDRLFPGAKVYEFGAAGVDIFFVLSGFIMVLTTFGK
DRDPAKFFLNRIIRIVPIYWIMTLAIVALFLIGFRPIGVIDLQLSYIWKSLFFIPFTRNG
LWEPILSVGWTLNFEIFFYSLFALLLFVPNFGMRIALLVTILICLASSGIILAKNPYLEY
YTSPVILDFAIGAAFGAFYVSRRENSPSANPTIAWILIASGALIIAVTGNGLGLSYSNNI
FRPMTWGLAGLMLISGCVFLEENGLVARNRLVIHLGNASYSIYLVHNLMIQVSEKAVGLF
FTPGLVALGIMALCALALTTIFGLASYKFIEYPINQGYRRITIKKQSIKELGFRI