Protein Info for Atu2832 in Agrobacterium fabrum C58

Annotation: tRNA modification GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF10396: TrmE_N" amino acids 7 to 122 (116 residues), 119.4 bits, see alignment E=2.1e-38 TIGR00450: tRNA modification GTPase TrmE" amino acids 19 to 442 (424 residues), 265.7 bits, see alignment E=8.7e-83 PF12631: MnmE_helical" amino acids 125 to 439 (315 residues), 164.6 bits, see alignment E=7.5e-52 TIGR00231: small GTP-binding protein domain" amino acids 220 to 314 (95 residues), 69.2 bits, see alignment E=3.5e-23 PF02421: FeoB_N" amino acids 221 to 308 (88 residues), 46.4 bits, see alignment E=6.2e-16 PF01926: MMR_HSR1" amino acids 221 to 314 (94 residues), 82.2 bits, see alignment E=6.3e-27

Best Hits

Swiss-Prot: 100% identical to MNME_AGRFC: tRNA modification GTPase MnmE (mnmE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to atu:Atu2832)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHB2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Atu2832 tRNA modification GTPase (Agrobacterium fabrum C58)
MPDSADTIYALSSGALPAGVAVIRISGAKAFIALRALTGRDLPLPRTASLCSIRNRNNEI
IDQSLVIVFPAPNSFTGENCVEIHSHGSRAVMASIFAELDNLGGLRPADAGEFSRRAFEN
GKMDLLEVEGLADLLQAETEMQRRLAVEQSSGQLSALYDGWANRLTRARALIEAELDFAD
EEDVPDSVATQVWEAMAALKGEINAHLQGGGNGEIIRDGFKVALVGEPNAGKSTLLNALS
GREVAIVTDIAGTTRDVLSVDINLDGYLVRIFDTAGIRETQDVVEREGVRRAVLTAETAD
LILILQDNDSTPKQSIGSFDNQRSLRVRTKTLLRSRASDDDFDLSISAKEGIGLDELRRA
LKREIEKRVGSGQTLVPARARHKKRLEETLNYVSDALDSETLDLAIRSEYLRLAATSLGR
ITGRVDVEDLLGVIFSEFCIGK