Protein Info for Atu2825 in Agrobacterium fabrum C58

Annotation: Sun protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF01029: NusB" amino acids 37 to 162 (126 residues), 83.6 bits, see alignment E=3.4e-27 PF01728: FtsJ" amino acids 272 to 395 (124 residues), 23.2 bits, see alignment E=1.1e-08 PF01189: Methyltr_RsmB-F" amino acids 273 to 458 (186 residues), 148.9 bits, see alignment E=3.2e-47 PF13649: Methyltransf_25" amino acids 276 to 342 (67 residues), 28.3 bits, see alignment E=4.7e-10

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to atu:Atu2825)

Predicted SEED Role

"16S rRNA m(5)C 967 methyltransferase (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW62 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Atu2825 Sun protein (Agrobacterium fabrum C58)
MTSDIQSKPARSRKPKPAHARGREDGPSSFEDKPGLAARIAATRILAAVLEKKTSMDGML
DSENGNPVYRALSLADRALVRAVVNSALRHLPRIETALSMLLDGPLPQGARSLHHVLVVG
AAQMLYLDVPDHSAVDLAVEQAHRDPRNRRFVKLVNAVLRRLGREKAEIEKAIADVPVLP
EWFYARLVSAYGDEVAQRISQAQLTPSCIDLTVKADPALWAERLGGTLMPNGSVRLGEFE
GQIPSLDGFAEGAWWVQDLAASMPVRLLGDISGKRVADLCAAPGGKTAQLALAGARVTAL
DQSGNRLRRLRENLDRLGLHAETVEANMLKYQPEQLFDAVLLDAPCSSTGTLRKHPDVCW
TKDENDIAKLAALQGQMLRHALTLVGPGGLVVFSNCSLDPSEGEEMIAEVLAENPDVERV
AVHREDWPGMEAAISAAGDLRTTPDMFGGVDGFFSSVLRKK