Protein Info for Atu2809 in Agrobacterium fabrum C58

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details PF03186: CobD_Cbib" amino acids 7 to 300 (294 residues), 310.5 bits, see alignment E=5.4e-97 TIGR00380: cobalamin biosynthesis protein CobD" amino acids 7 to 271 (265 residues), 199.4 bits, see alignment E=4.2e-63

Best Hits

Swiss-Prot: 54% identical to COBD_SINSX: Cobalamin biosynthesis protein CobD (cobD) from Sinorhizobium sp.

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to atu:Atu2809)

MetaCyc: 54% identical to adenosylcobinamide-phosphate synthase (Pseudomonas denitrificans (nom. rej.))
Adenosylcobinamide-phosphate synthase. [EC: 6.3.1.10]

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHC0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Atu2809 cobalamin biosynthesis protein (Agrobacterium fabrum C58)
MFFALAFLSLVIERLTGYPDWLFKRIGHPVTWIGSLIALMDKKWNRESASFSQRKAAGVA
ALVVFVGLTVILAWFAQSVLLFLPFGLLAVAIFGASLPAQQSLEQHVEAVATALEREGVE
GGRKAVSMIVGRDPQKLDEAAICRAAIESLAENFSDGIVAPAFWLGFLGLPGGAAYKAIN
TADSMIGHRSPRHEAFGWASARLDDLVNLPASRLSGSLFVVAAFFVEGASPKAAIAAIRR
DARHHRSPNAGWPEAALAGALGFALAGPRSYGGQMIEARFMGEGGRSALVAGDIRKALRL
ARIADLLLIGLFGLLAILIAL