Protein Info for Atu2805 in Agrobacterium fabrum C58

Annotation: cobalamin synthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR02475: cobalamin biosynthesis protein CobW" amino acids 6 to 342 (337 residues), 554 bits, see alignment E=5.3e-171 PF02492: cobW" amino acids 9 to 212 (204 residues), 188.2 bits, see alignment E=1e-59 PF07683: CobW_C" amino acids 254 to 345 (92 residues), 72.3 bits, see alignment E=2.5e-24

Best Hits

Swiss-Prot: 53% identical to COBW_SINSX: Protein CobW (cobW) from Sinorhizobium sp.

KEGG orthology group: K02234, cobalamin biosynthesis protein CobW (inferred from 100% identity to atu:Atu2805)

Predicted SEED Role

"CobW GTPase involved in cobalt insertion for B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHC1 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Atu2805 cobalamin synthesis protein (Agrobacterium fabrum C58)
MSTLLDRVPCTIVTGFLGAGKTTLLRGLLEKLDGKRLAIIVNEFGDIGIDGEILKGCGIE
SCPEENIVELANGCICCTVADDFQPAIEQILSRQPKVEHILIETSGLALPKPLVQAFQWP
AIKSRVTVDAVVAVVDGAALAEGQVAHDMEALAAQRANDEALDHDDPVEEVFEDQVACAD
LIVLTKADLLDDAGLEKAKAHILEHLPKAAKIVVASNGAIDPTVLIGLGLAVEEDIENRR
THHDGELDHEHDDFDSFVIDLPAVTDPEALAARIAQTAAAENVLRIKGFIEVATKPMRLQ
VQAVGSRVNHYYDRPWAAGEERRSRLVVIGEKGINREKIEQMLAA