Protein Info for Atu2801 in Agrobacterium fabrum C58

Annotation: precorrin-2 C20 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR01467: precorrin-2 C(20)-methyltransferase" amino acids 11 to 243 (233 residues), 225.1 bits, see alignment E=4.1e-71 PF00590: TP_methylase" amino acids 12 to 225 (214 residues), 148.1 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 66% identical to COBI_SINSX: Precorrin-2 C(20)-methyltransferase (cobI) from Sinorhizobium sp.

KEGG orthology group: K03394, precorrin-2/cobalt-factor-2 C20-methyltransferase [EC: 2.1.1.130 2.1.1.151] (inferred from 100% identity to atu:Atu2801)

MetaCyc: 66% identical to CobI (Pseudomonas denitrificans (nom. rej.))
Precorrin-2 C(20)-methyltransferase. [EC: 2.1.1.130]

Predicted SEED Role

"Cobalt-precorrin-2 C20-methyltransferase (EC 2.1.1.130)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.130 or 2.1.1.151

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHC4 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Atu2801 precorrin-2 C20 methyltransferase (Agrobacterium fabrum C58)
MSAALFEHAKGKLVGVGTGPGDPELLTLKAVRAIENADVLAFFCKKGSAGNGRGIVEAFI
RPGTLEMPLVYPVTVESDKNGEDYRGAIAAFFDQSAKDIAVHLDAGRNVAVLSEGDPLFY
GSYMHLHLRLAPSYEAEVVAGITAMSGCWSMAGLPLVQGDDILSVLPGTLAEEVLAERLS
GTDGAVIMKVGRNLPKIRRALEVAGKLEEALYVERGTMANSHAVRLIERDASPAPYFSLV
LVPGWKTRPAGSEGS