Protein Info for Atu2794 in Agrobacterium fabrum C58

Annotation: uroporphyrin-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 20 to 254 (235 residues), 270.6 bits, see alignment E=7.1e-85 PF00590: TP_methylase" amino acids 22 to 230 (209 residues), 151.6 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 47% identical to SUMT_SINSX: Uroporphyrinogen-III C-methyltransferase (cobA) from Sinorhizobium sp.

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 100% identity to atu:Atu2794)

MetaCyc: 47% identical to CobA (Pseudomonas denitrificans (nom. rej.))
Uroporphyrinogen-III C-methyltransferase. [EC: 2.1.1.107]; 2.1.1.107 [EC: 2.1.1.107]

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW90 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Atu2794 uroporphyrin-III C-methyltransferase (Agrobacterium fabrum C58)
MSIPQILNSIAAKGPVFEAGHVWLAGAGPGDVRYLTLEVALALSQADIIVRDALVSDDVV
ALGPQAEVVFAGKRGGKPSATQDDITASLIDFALQGKKVLRLKGGDPFIFGRGGEEAEAL
VHAGIPFRILPGMTSSFTALASARIPATMRGISRAVTLATGHAAGTEEDLDWLALAKTQE
PIVVYMGLKNIGTIAGLLMQGGRSGKTPVAVIMSATTAKERIFIGTLQSIADDAKRESFE
APALIIIGEIVSMRDRLGVSGS