Protein Info for Atu2793 in Agrobacterium fabrum C58

Annotation: cobyrinic acid a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 6 to 403 (398 residues), 329.5 bits, E=1.8e-102
• PF01656: CbiA
  • amino acids 6 to 192 (187 residues), 55.8 bits, E=6.9e-19
• PF07685: GATase_3
  • amino acids 248 to 435 (188 residues), 103.6 bits, E=1.7e-33

Best Hits

Swiss-Prot: 100% identical to COBB_AGRFC: Hydrogenobyrinate a,c-diamide synthase (cobB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to atu:Atu2793)

MetaCyc: 47% identical to CobB (Pseudomonas denitrificans (nom. rej.))
Hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolyzing). [EC: 6.3.5.9]

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (12/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (12/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See Q8UBQ8 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Atu2793 cobyrinic acid a,c-diamide synthase (Agrobacterium fabrum C58)
MTARAIIIGAPRSGSGKTSVTIGLLRAFARRGVKVRGIKTGPDYIDPGFHAFATGTPGLN
LDSWAMQPDLLRHLFSQQTEDAELILIESAMGLFDGIPVAENRTGSAADLARLFRIPVLL
VLDVSGQSQTAATIAHGFAHYDPDVTMGAVVLNRAGSERHRTLCTEAIEKIGLPVVGCVL
RDPSLILPERHLGLVQASEHPEIDPHIDRLADAMEKSIDLDTLFSLAAPVDMPCGSVAAA
IAPPGQRIALAEDAAFTFLYPHLRRHWRAAGAEIVPFSPLADEAPDESCDICWLPGGYPE
LFAGKLADAVGFKAGITRFAETKPVHGECGGYMVLGERLEDAEGVIHAMTGLLSHATSFA
TRKMNLGYRQATIAADSPLGMAGDVLRGHEFHYARVIDPGRDQPFAHMADGQGRPLGPSG
GRRGFVSGTFFHAIAKGG