Protein Info for Atu2788 in Agrobacterium fabrum C58

Annotation: citrate lyase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03328: HpcH_HpaI" amino acids 5 to 223 (219 residues), 131.4 bits, see alignment E=3.2e-42 PF15617: C-C_Bond_Lyase" amino acids 11 to 284 (274 residues), 30.6 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 43% identical to MCTE_RHOSK: (3S)-malyl-CoA thioesterase (mcl2) from Rhodobacter sphaeroides (strain KD131 / KCTC 12085)

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 100% identity to atu:Atu2788)

Predicted SEED Role

"Citrate lyase beta chain (EC 4.1.3.6)" (EC 4.1.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHD0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu2788 citrate lyase, beta subunit (Agrobacterium fabrum C58)
MRPRRSLLSVPAINIRALEKIRELDCDGVILDLEDSVAPDMKGKARENLEKLFSGPPFDG
RETIIRINPLSTPDGKADLQLVLSCRPDAVLLPKVEQPSDIHDVADFLAEADAPEHLKIW
AMIETPLGVLNAASIADAAHTPNARLAAFVIGLNDLRKETHVPRLPGRTYLVPWMMQVIL
AARAYGLDVIDSVSNDFRDIEAFEAECEQGRAMGFDGKMLIHPAQIEAANRHFGPDEATL
AEARAIIAAFAKPESVELNIINMNGQMIERLHVGQAERLVAMADIIAQRKAKKT