Protein Info for Atu2779 in Agrobacterium fabrum C58

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF00171: Aldedh" amino acids 7 to 277 (271 residues), 49.7 bits, see alignment E=1.1e-17 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 8 to 402 (395 residues), 442.6 bits, see alignment E=5.9e-137

Best Hits

Swiss-Prot: 100% identical to PROA_AGRFC: Gamma-glutamyl phosphate reductase (proA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 100% identity to atu:Atu2779)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBS1 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Atu2779 gamma-glutamyl phosphate reductase (Agrobacterium fabrum C58)
MMTIGAQAKAASRPLSIAGTDQKNRALLAMASAIEASKEAILAANRKDLAAAESAGLAAS
FVDRLTLNDARIAGIAEGIRSVAALADPVGEVIAAWDRPNGLKIERVRTPLGVIGVIYES
RPNVTADAGALCLKAGNAVILRGGSDSQHSSRAIHACLVQGLRIAGLPENAIQLVPVTDR
AAVGALLSGLKGTVDVIVPRGGKSLVARVQSEARVPVFAHLEGICHIYVDKSADLDMAKA
IVVNAKMRRTGICGAAETLLVDASAVSSHLEPVVKALLDAGCEVRGSQPVRNVVEGLEAA
TEEDWRTEYLDAIISVAVVDGISGAIEHIGTYSSNHTEAVIAEDPDVVARFFNELDSAIL
LHNASTQFADGGEFGMGAEIGIATGKMHARGPVGVEQLTSFKYRVHGTGQTRT