Protein Info for Atu2772 in Agrobacterium fabrum C58

Annotation: Invasion protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF00293: NUDIX" amino acids 10 to 159 (150 residues), 74.7 bits, see alignment E=3.7e-25

Best Hits

Swiss-Prot: 100% identical to RPPH_AGRFC: RNA pyrophosphohydrolase (rppH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 100% identity to atu:Atu2772)

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBS8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Atu2772 Invasion protein A (Agrobacterium fabrum C58)
MTIKAEDLPYRPCAGIMVLNAQGLVWAGRRIKEGNSEYDGSPQLWQMPQGGIDDGERPLT
AAIRELYEETGMKTVTLLAEASDWIHYDLPPELIGIGLRGKYRGQAQRWFAFRFEGDESE
IQIDPPPTGHSAEFDAWDWKPMESLPELIVPFKRAVYEKVVAEFQHLSGK