Protein Info for Atu2765 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, CarD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF02559: CarD_TRCF_RID" amino acids 14 to 72 (59 residues), 50.3 bits, see alignment E=2e-17 PF21095: CarD_C" amino acids 81 to 165 (85 residues), 86.9 bits, see alignment E=7.6e-29

Best Hits

KEGG orthology group: K07736, CarD family transcriptional regulator (inferred from 99% identity to agr:AGROH133_09195)

Predicted SEED Role

"CarD-like transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHD6 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Atu2765 transcriptional regulator, CarD family (Agrobacterium fabrum C58)
MTTQQKKSPAHHGFKTGEAIVYPAHGVGTISAIEEQEVAGMKLELFVIDFEKDKMRLKVP
VAKAVSIGMRKLSEGDFVERALKVVQGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR
DLYRAENQPEQSYSERQLYEAALDRMAREIAAVNKMSETEAVRLVEVNLAKGPKRGKTVE
EDDSQDEAA