Protein Info for Atu2743 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 5 to 11 (7 residues), see Phobius details transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 315 to 343 (29 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details PF06808: DctM" amino acids 8 to 415 (408 residues), 407.2 bits, see alignment E=3.9e-126 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 419 (403 residues), 451.7 bits, see alignment E=1e-139

Best Hits

Swiss-Prot: 55% identical to Y1029_HAEIN: Putative TRAP transporter large permease protein HI_1029 (HI_1029) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to agr:AGROH133_09138)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHF1 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu2743 hypothetical protein (Agrobacterium fabrum C58)
MTLFVFVGSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTAIIAQNMISGADTFTLLAIP
FFILAGELMNSGGLSRRIIDFAIALVGHIRGGLGIVAIVAAIIMASISGSAAADTAALAA
ILIPMMAKAGYNIPRSGGLIAAGGIIAPVIPPSMAFIVFGVAANVSITQLFLAGIVPGIL
MGISLIIAWLIVVRKDNIKPLPKTSGKERLVATVRAGWALGMPVIILGGIKAGIMTPTEA
AVVAAGYALFVGMVIYRELKPADLFHVLLRAAKSTSIIMFLVCAALVSAWLITAANIPNE
VAGYIEPLIDRPMLLMVAMMVLVFIVGTALDLTPTILILTPVLMPIVKQAGIDPVYFGVL
FIINNAIGLITPPVGVVLNVVSGVGRIPLGKVTIGVWPFLVAETIVLALLVIFPDIVMVP
LQYLR