Protein Info for Atu2728 in Agrobacterium fabrum C58

Annotation: beta (1-->2) glucan export ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details TIGR01192: glucan exporter ATP-binding protein" amino acids 1 to 585 (585 residues), 1184.3 bits, see alignment E=0 PF00664: ABC_membrane" amino acids 22 to 288 (267 residues), 138.6 bits, see alignment E=3.3e-44 PF00005: ABC_tran" amino acids 351 to 500 (150 residues), 122 bits, see alignment E=3e-39

Best Hits

Swiss-Prot: 100% identical to NDVA_AGRFC: Beta-(1-->2)glucan export ATP-binding/permease protein NdvA (ndvA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to atu:Atu2728)

Predicted SEED Role

"Beta-(1-->2)glucan export ATP-binding/permease protein NdvA (EC 3.6.3.42)" (EC 3.6.3.42)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A2V0 at UniProt or InterPro

Protein Sequence (588 amino acids)

>Atu2728 beta (1-->2) glucan export ATP-binding protein (Agrobacterium fabrum C58)
MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEPVLFGRIIDAISSGTNVTPILI
LWAGFGVFNTVAYVAVAREADRLAHGRRATLLTEAFGRIISMPLSWHHLRGTSNALHTLL
RASETLFGLWLEFMRTHLATFVALVLLIPTAMAMDLRLSFVLIGLGIVYWFIGKWVMGRT
KDGQASVEEHYHSVFAHVSDSISNVSVLHSYNRIEAETKALKSFTEKLLSAQYPVLDWWA
FASALNRTASTVSMMIILVIGTVLVKNGELRVGDVIAFIGFANLLIGRLDQMRQFVTQIF
EARAKLEDFFVLEDAVKEREEPGDARELSNVSGTVEFRNINFGFANTKQGVHDVSFTAKA
GETVAIVGPTGAGKTTLINLLQRVYDPDSGQILIDGTDISTVTKNSLRNSIATVFQDAGL
LNRSIRENIRLGRETATDAEVVEAAAAAAATDFIDSRINGYLTQVGERGNRLSGGERQRI
AIARAILKNAPILVLDEATSALDVETEARVKAAVDALRKNRTTFIIAHRLSTVRDADLVL
FLDQGRIIEKGTFDELTQRGGRFTSLLRTSGLLTEDEGQQPRPKAIAS