Protein Info for Atu2722 in Agrobacterium fabrum C58

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 1 to 81 (81 residues), 64.2 bits, see alignment E=1.7e-21 PF13488: Gly-zipper_Omp" amino acids 39 to 84 (46 residues), 36.5 bits, see alignment 7.3e-13 PF00691: OmpA" amino acids 114 to 209 (96 residues), 75.1 bits, see alignment E=9.8e-25

Best Hits

Swiss-Prot: 51% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2722)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHG4 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Atu2722 porin (Agrobacterium fabrum C58)
MIKKIAIVALCGTYLSACTTTDPYTGEQKMSNTAGGAGIGAVVGALGGLAVGGSPVGRRN
AALIGAGIGALAGGAIGNYMDGQEAELRAQLQGTGVSVTRRGDSIVLNMPSNITFATDQD
QVIPPFYQTLDSVAIVLNKFNRTLIDINGHTDSTGSLQHNQALSERRAASVANYLGARGV
DQRRISTLGFGPSQPIASNATSDGRAQNRRVEVLISPLKG