Protein Info for Atu2718 in Agrobacterium fabrum C58

Annotation: homoserine O-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR01001: homoserine O-succinyltransferase" amino acids 1 to 299 (299 residues), 389.4 bits, see alignment E=6.9e-121 PF04204: HTS" amino acids 2 to 298 (297 residues), 434.2 bits, see alignment E=1.1e-134

Best Hits

Swiss-Prot: 100% identical to METAA_AGRFC: Homoserine O-acetyltransferase (metAA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 100% identity to atu:Atu2718)

MetaCyc: 100% identical to homoserine O-acetyltransferase (Agrobacterium fabrum C58)
Homoserine O-acetyltransferase. [EC: 2.3.1.31]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31 or 2.3.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWE8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Atu2718 homoserine O-succinyltransferase (Agrobacterium fabrum C58)
MPIKIPDTLPAFETLVHEGVRVMTETAAIRQDIRPLQIGLLNLMPNKIKTEIQMARLVGA
SPLQVELSLIRIGGHRAKNTPEEHLLSFYQTWEEVRHRKFDGFIITGAPIELLDYEDVTY
WNEMQQIFEWTQTNVHSTLNVCWGAMAAIYHFHGVPKYELKEKAFGVYRHRNLSPSSIYL
NGFSDDFQVPVSRWTEVRRADIEKHPELEILMESDEMGVCLAHEKAGNRLYMFNHVEYDS
TSLADEYFRDVNSGVPIKLPHDYFPHNDPELAPLNRWRSHAHLFFGNWINEIYQTTPYDP
QAIGKLAA