Protein Info for Atu2716 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 PF00005: ABC_tran" amino acids 21 to 148 (128 residues), 83.9 bits, see alignment E=8.6e-27 amino acids 300 to 433 (134 residues), 85.3 bits, see alignment E=3.1e-27 PF16326: ABC_tran_CTD" amino acids 532 to 600 (69 residues), 58.5 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2716)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHG6 at UniProt or InterPro

Protein Sequence (608 amino acids)

>Atu2716 ABC transporter, nucleotide binding/ATPase protein (Agrobacterium fabrum C58)
MAPPILKLDDIKLTFGVTPLLDGANLQVEPGDRICLVGRNGSGKSTLMKIAAGLVEAQSG
EVFRHPAATIRYLEQAPDFAGYATVQAYAEAGLGPGDDPYRVTYLLEHLGLTGQENPESL
SGGEARRVALARVMAPEPDILMLDEPTNHLDLPTIEWLEGELQQTRSALVLISHDRRFLE
KVSTSTVWLDRGQSRRLNRGFAHFEEWRDKVLEEEELEQHKLGKAIEREEHWMRYGVTAR
RKRNMRRVGELQAMRADYRGHKGPQGSVQATVTEGRESGKLVIEADAISKAYGERVIVAP
FSLRVHRGDCIGLVGPNGAGKTTLLKMLTGELEPDSGTVKLGTNLEIATLDQKREDLNPN
ETLAHYLTDGRGDNLLVNGEVKHVTGYMKDFLFQPEQARTPIRNLSGGERARLILARILA
RPTNLLILDEPTNDLDIETLDLLQEIVAGFSGTVILVSHDRDFLDRTVTSTIAPANPDQP
DGRWIEYAGGYSDMMAQRKGAADEKRKAERQEKAKAVSSASPSQEPAKAKGKLSFKQKFA
LENLPKEMEKTQEEIAKREQRMADPQLFAKDQATFNKLAQEMEKLREKLETMEEEWLELE
MLREELES