Protein Info for Atu2706 in Agrobacterium fabrum C58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 18 to 434 (417 residues), 388.7 bits, see alignment E=1.8e-120 PF25994: HH_AprE" amino acids 93 to 283 (191 residues), 125.4 bits, see alignment E=3.1e-40 PF26002: Beta-barrel_AprE" amino acids 325 to 413 (89 residues), 102.2 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 56% identical to PRSE_RHIME: Type I secretion system membrane fusion protein PrsE (prsE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02022, (no description) (inferred from 100% identity to atu:Atu2706)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHH0 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Atu2706 HlyD family secretion protein (Agrobacterium fabrum C58)
MADAEKTGTTNSSILRHSAAVVVLGLGLLVGMGGWAAFAKLAGAVVATGRVVVEGNSKKI
QHLSGGIVSEINVVEGDRVAAGQILLRLSATVVQANLSIIENTLAQLYSRRARLRAEIAE
EPSFTVTEDLTALTSSKSAKTFIDSEQNLFNSRRNALIGMKKQLATRKLQLADEARGLDV
QVEATENELAIVKEDVSKTDELLKKGLVTLQRLNLLKRQLSNLEGQQGQYIAARAQTVGK
LSELDLQLLQLDEDRKSEVTKDLTSIEATVAEYEERLAATRDQLDRLDIRSPIAGRIYQL
SVHNINGVIQPGEVLMLVVPDKDDLAIEANITPRDIDQIYVGQPVTVRFTAFNQSTTPDL
SAEVAVVAPDLQTDSRTGTSYYVLRIRPNKAGMGHLPGGKLYPGMPAEVFIQTSERSVLS
YFVKPFQDRLKKTFVQE