Protein Info for Atu2678 in Agrobacterium fabrum C58

Annotation: 2'-5' RNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR02258: 2'-5' RNA ligase" amino acids 2 to 176 (175 residues), 158.9 bits, see alignment E=6.3e-51 PF02834: LigT_PEase" amino acids 8 to 85 (78 residues), 59.2 bits, see alignment E=3.7e-20 amino acids 92 to 166 (75 residues), 49.3 bits, see alignment E=4.6e-17 PF13563: 2_5_RNA_ligase2" amino acids 36 to 160 (125 residues), 58.8 bits, see alignment E=6.7e-20

Best Hits

KEGG orthology group: K01975, 2'-5' RNA ligase [EC: 6.5.1.-] (inferred from 100% identity to atu:Atu2678)

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWH9 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Atu2678 2'-5' RNA ligase (Agrobacterium fabrum C58)
MPRLFTALEIPRNAAMSLSLLRGGLPGARWIDVENYHITLRFIGDIDGRTADEVVDRLDR
IERPEFQLNLTGIGSFGSKKPHSIWAGVSPSPEMHALQAEVERICQRIGLPPDPRKFMPH
VTLARLRSSRVDDVVHYLSGRGNFRTSPFTVGRFVLMSSKESVGGGPYVVEEAFPLHEAR
SSSIFSSNDLHPAKSML