Protein Info for Atu2676 in Agrobacterium fabrum C58
Annotation: 4a-hydroxytetrahydrobiopterin dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PHS_AGRFC: Putative pterin-4-alpha-carbinolamine dehydratase (Atu2676) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 100% identity to atu:Atu2676)Predicted SEED Role
"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)
MetaCyc Pathways
- tetrahydropteridine recycling (2/2 steps found)
- L-phenylalanine degradation V (2/3 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.96
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8UC22 at UniProt or InterPro
Protein Sequence (101 amino acids)
>Atu2676 4a-hydroxytetrahydrobiopterin dehydratase (Agrobacterium fabrum C58) MKYPRLEPDAIRQALSKLEGWSLREDGAAIVRSFKFSSFAEAFGFMAESALAAEKLNHHP EWSNVYSRVKVCLTTHDSQGVTERDFLLAEAMQKAAAGRGN