Protein Info for Atu2650 in Agrobacterium fabrum C58

Annotation: glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 5 to 108 (104 residues), 23 bits, E=2.5e-08
• PF01210: NAD_Gly3P_dh_N
  • amino acids 5 to 160 (156 residues), 126.2 bits, E=3.1e-40
• PF02558: ApbA
  • amino acids 6 to 111 (106 residues), 34.3 bits, E=4.6e-12
• PF07479: NAD_Gly3P_dh_C
  • amino acids 180 to 316 (137 residues), 152.1 bits, E=3e-48
• PF20618: GPD_NAD_C_bact
  • amino acids 240 to 302 (63 residues), 58.2 bits, E=2.4e-19

Best Hits

Swiss-Prot: 100% identical to GPDA_AGRFC: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to atu:Atu2650)

MetaCyc: 45% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (12/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See Q8UC48 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu2650 glycerol-3-phosphate dehydrogenase (Agrobacterium fabrum C58)
MQREKIVVIGAGAFGTALAVVIALENRHDVTLLGRDPSLMADLRNERVHEAALPGVELPD
ALGFSAEPDVLAGASIVLFAMPSQAHADAAQHYGPYLASDSIIVTCAKGIDRNSGRLLTE
LLETELPHHPIAVLSGPGFAADIARGLPTAMAIAAEDATVAERLATTISGKTFRLYASTD
RIGVQLGGALKNVLAIAAGIVEGAGLGDSARAALISRGLAEMSRLIVAMGGKADTVRGLS
GLGDLVLTATSHQSRNLRFGIALGRGEGKDMSGGLVEGAFAAAVAARLGEHHAIDMPVTE
AVAAIIDGNLDVASAMQQLMTRPITTE