Protein Info for Atu2645 in Agrobacterium fabrum C58

Annotation: succinate dehydrogenase cytochrome B-556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 28 to 55 (28 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details PF01127: Sdh_cyt" amino acids 5 to 121 (117 residues), 99.7 bits, see alignment E=6.1e-33 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 6 to 125 (120 residues), 132 bits, see alignment E=6.5e-43

Best Hits

Swiss-Prot: 40% identical to DHSC_PARDE: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Paracoccus denitrificans

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 100% identity to atu:Atu2645)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWK3 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Atu2645 succinate dehydrogenase cytochrome B-556 subunit (Agrobacterium fabrum C58)
MANVTNNRPLSPHLQIYKPIPTMVASIVHRITGGALYFGTLLVAWWLIALASGPAYYDWV
NWAMGTIIGRLILIGYTWALVHHMLGGLRHFMWDLGHGFDKHFTTKLAKASWVASICLTA
LIWVIVLIVR