Protein Info for Atu2635 in Agrobacterium fabrum C58

Annotation: dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 4 to 409 (406 residues), 566.9 bits, see alignment E=1.5e-174 PF00364: Biotin_lipoyl" amino acids 4 to 76 (73 residues), 77.1 bits, see alignment E=1.1e-25 PF02817: E3_binding" amino acids 118 to 149 (32 residues), 30.1 bits, see alignment (E = 6.8e-11) PF00198: 2-oxoacid_dh" amino acids 180 to 407 (228 residues), 279.9 bits, see alignment E=2.4e-87

Best Hits

Swiss-Prot: 70% identical to ODO2_BARVB: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Bartonella vinsonii subsp. berkhoffii

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to atu:Atu2635)

MetaCyc: 51% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.105 or 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHK2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Atu2635 dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (Agrobacterium fabrum C58)
MATEIRVPTLGESVSEATVGTWFKKVGDTVKADEPLVELETDKVTVEVPAPASGVLTEIV
AQNGETVGLDALLGQIAEGAAGAATSAPAAKPAAPAAAPAPAAAVAAAPGGSAMPPAPAA
GKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGVSAPAAAPAPVAAPRPVSAEQDQVR
EERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMDLRNRYKDVFEKKHGVKLGFM
GFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVVPVIRDADQLSIAGV
EKELGRLAKAARDGSLGMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILGMHKIQERP
VAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL