Protein Info for Atu2625 in Agrobacterium fabrum C58

Annotation: ATP Synthase delta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 11 to 182 (172 residues), 175.8 bits, E=4.3e-56
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 11 to 181 (171 residues), 126.2 bits, E=8e-41

Best Hits

Swiss-Prot: 100% identical to ATPD_AGRFC: ATP synthase subunit delta (atpH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to atu:Atu2625)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See Q7CWL8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Atu2625 ATP Synthase delta chain (Agrobacterium fabrum C58)
MAETSQGTSGVAERYASSLFELALEAGTVEAVQVELDKFGALLDESDDLKRLVASPVFSA
EDQFKAISAICEKAGIAGLAVNFLKVVANNRRLFAVPGMIRAYRTIAAAHRGEITAEVTS
AHALDEAQETELKAALKSVTGKDVAISVTVDPSILGGLIVKVGSRQIDTSLRTKLSTLKL
ALKEVG