Protein Info for Atu2603 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (maltose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 289 (206 residues), 50.2 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 37% identical to Y3749_BRUSU: Probable ABC transporter permease protein BRA0749/BS1330_II0742 (BRA0749) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu2603)

Predicted SEED Role

"ABC sugar transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHL2 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu2603 ABC transporter, membrane spanning protein (maltose) (Agrobacterium fabrum C58)
MDAKRSAVIFAWFLLLPALFYITLIVAYPLVDTFILSFTDASLKKVTNWVGFINYEKIFN
ATFADVITRTFVWTFFSVSIKMIIGTFGAVLLNSAVPGRALFRILTMPPWIVPMAIGIFM
WGWMYNGQFGMISGVLQNLGLVDGPVAFLAYGRTAFWATIVTDVWIGVPMVTLYLLAAIQ
SIPQDLYEAAWTDGASRSYRFRRITLPLMLPAMITMSVLSLISTFNSFDIIWILTRGGPN
GETTTMIIDTYKTAIGAYKYGEGAARAVLICIFLSIFTFFYFRITRRFSQEATR