Protein Info for Atu2597 in Agrobacterium fabrum C58

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 8 to 192 (185 residues), 147.9 bits, see alignment E=6.7e-47 PF01370: Epimerase" amino acids 10 to 96 (87 residues), 23.1 bits, see alignment E=1.1e-08 PF08659: KR" amino acids 10 to 153 (144 residues), 33.3 bits, see alignment E=1.2e-11 PF02254: TrkA_N" amino acids 10 to 78 (69 residues), 24.2 bits, see alignment E=8.7e-09 PF13561: adh_short_C2" amino acids 13 to 244 (232 residues), 187.3 bits, see alignment E=8.7e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2597)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHL6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Atu2597 short-chain dehydrogenase (Agrobacterium fabrum C58)
MNDRKDQLAIVTGAAGDIGRAIAAALSESHKKVVLVDIDADALSDALYKLSGPGFVAKTC
DVTDPQDLARLAAEVAEFGEVATLVNNAGAARAVSLHDTTAEIWRKDNALNLEAPFLCFR
AFEEALKRTQGSVINITSVNGMAVFGHPAYSAAKAGLIHLTKLIAVEYGKFGIRANAVAP
GTVRTQAWEARAATNPQVFEEAKHWYPLQRIVRPEDVANAVAFLAGPQAAAISGVCLPVD
CGLTAGQAPLARTFSQSEHY