Protein Info for Atu2583 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF13692: Glyco_trans_1_4" amino acids 196 to 325 (130 residues), 87 bits, see alignment E=3e-28 PF00534: Glycos_transf_1" amino acids 200 to 338 (139 residues), 97 bits, see alignment E=1.9e-31 PF13524: Glyco_trans_1_2" amino acids 215 to 353 (139 residues), 30.7 bits, see alignment E=5.6e-11 PF20706: GT4-conflict" amino acids 248 to 357 (110 residues), 36.2 bits, see alignment E=7.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2583)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWQ4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Atu2583 glycosyltransferase (Agrobacterium fabrum C58)
MKIAFYSPLKSPYHPVPSGDRLMARLLMKAMTMAGHEVFVASELRSFLKQPDDPARPALI
DEAGREIEAIAERWRQEGAPDLWFCYHPYYKAPDLLGPELVHRFGIAYVTAEASYSPKRN
GMGWQAIQDGLLAALNGAAVNICFTARDREGLVRASPTLQWAILPPFIDAGAFLSNIPRP
EPARLITVAMMRAGDKLSSYRTLSEALALLPETLDWTLDIIGDGPERAAVETMFSAFPDH
RLGWHGEKSPTEIATLLSKASLYVWPGHGEAYGLAYLEAQAAGLPVVAEKVAGVPEVVKS
GTTGLLTPENDTAAYAEAIRTLLGDDRQREELAKAARQFVINERSLENAATTLNQILLQA
KARRS