Protein Info for Atu2572 in Agrobacterium fabrum C58

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF02771: Acyl-CoA_dh_N" amino acids 23 to 100 (78 residues), 36.9 bits, see alignment E=4.3e-13 PF00441: Acyl-CoA_dh_1" amino acids 232 to 367 (136 residues), 34 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 100% identity to atu:Atu2572)

Predicted SEED Role

"putative acyl-CoA dehydrogenase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHM8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Atu2572 acyl-CoA dehydrogenase (Agrobacterium fabrum C58)
MNVTVAPQDETLSARAGRVATIAAKHADDVDVTGRFPQEAVDALRRERLLGIQVPSSLGG
EGASIQEIADICARLGQACSATAMIFAMHHIKLSSLVEHGVDSTWHPGFMRRVAGEQLLL
GSATTEGGIGGNLRNSICAIEVEGDSCRLEKDATVISYGSNADAILITSRAHKDAAPADQ
VMTVFLKNQYTLEKTHVWDTLGMRGTCSDGFLFRGEAPAAQIFPKPFAEIAAQSMLASSH
LLWSAVWYGIASDAVLRAQSFVRAAARKSPGTAPPGAIRLAEVSTKLQVVKSNIIAGIKA
YEDTKSDPEKLMSMAFAVAMNNVKICSSETILEIIDHAMLVCGIMGYKNGTPYSLGRHLR
DAHSARLMISNDRILGNSANLLLVHRQDTSLLG