Protein Info for Atu2562 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (molybdate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 17 to 225 (209 residues), 215.8 bits, see alignment E=2.5e-68 PF00528: BPD_transp_1" amino acids 31 to 232 (202 residues), 75.4 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 62% identical to MODB_ECO57: Molybdenum transport system permease protein ModB (modB) from Escherichia coli O157:H7

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to atu:Atu2562)

MetaCyc: 62% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWS1 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Atu2562 ABC transporter, membrane spanning protein (molybdate) (Agrobacterium fabrum C58)
MALHWWTLSPEEWTAIRLSLWVSSIAMLASLPFGIAVAVALARGRFWGKSLLNGIVHLPL
ILPPVVTGFLLLVLFGRRGAIGQFLDSWFGIVFSFRWTGAALACAVMAFPLMVRSIRLSI
EAVDRKLEEAAGTLGASPLWVFLTVTLPLTLPGIIAGMILAFAKAMGEFGATITFVSNIP
GETQTLSAAIYTFTQVPGGDAGALRLTIVSVVISILALLVSELLARIIGKRVSME