Protein Info for Atu2517 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (dipeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 14 to 106 (93 residues), 44 bits, see alignment E=2.4e-15 PF00528: BPD_transp_1" amino acids 118 to 339 (222 residues), 128.3 bits, see alignment E=3e-41

Best Hits

Swiss-Prot: 40% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu2517)

MetaCyc: 42% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHQ0 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Atu2517 ABC transporter, membrane spanning protein (dipeptide) (Agrobacterium fabrum C58)
MTLNKRVKSISSILGSVILTLFGLMIITFMIGRVMPVDPVIAAVGDNAPEDVIVRVRAEM
GLDQPLVVQFFHYVTQVLHGDFGNSILTRNPVWIDIKRVFPATFELATAALILAALIGIP
LGVWAAVKQGKLTDQVIRVVCLAGHSVPVFMLALISLLVFYATLGVAPGPGRQDIIYDGM
ITQVTGLMTVDTLLAGDWGAFYDAVAHMVQPVCILAYFSMAYITRMTRAFMIDALKGEYV
ITARAKGLSAMTVIWGHAFPTVAVQLVTVLALTYAGLLEGAVVTETVFSWPGLGQYLTVS
LMNADMNPVVGATLLIGIIYVGLNLLADVLYRVMDPRVR