Protein Info for Atu2516 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (dipeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 141 to 177 (37 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details PF12911: OppC_N" amino acids 28 to 74 (47 residues), 50.7 bits, see alignment 1.4e-17 PF00528: BPD_transp_1" amino acids 117 to 298 (182 residues), 108.2 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 45% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu2516)

MetaCyc: 47% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHQ1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2516 ABC transporter, membrane spanning protein (dipeptide) (Agrobacterium fabrum C58)
MMLANFRNWALDETPHSRTQAAWGNRYRIWLNLKSNPLAVIGLTIIVLFIALSLLAPAIA
PYDPATQNLGNRLAFPNAEHWFGTDELGRDILSRILYGGRVTLGMVIAVVVLVAPIGLAI
GCIAGYFGGIVDTVLMRVTDVFLAFPRLILALAFVAALKPGVESAILAIALTAWPPYARL
ARAETMTVRGSDFVAAYRLTGASAWRIIARHIAPLCVPSLIVRITLDMSSIIITAASLGF
LGMGAQPPSPEWGAMIATAKRFIFEQWWVATIPGIAIFLVSLAFNFLGDGLRDVLDPKGH