Protein Info for Atu2495 in Agrobacterium fabrum C58
Annotation: flavoprotein oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RUTF_AGRFC: FMN reductase (NADH) RutF (rutF) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 100% identity to atu:Atu2495)MetaCyc: 49% identical to cob(II)yrinate a,c-diamide reductase monomer (Brucella melitensis)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]
Predicted SEED Role
"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
- adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
- adenosylcobalamin salvage from cobalamin (5/5 steps found)
- adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
- adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)
- cobalamin salvage (eukaryotic) (4/8 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Methane metabolism
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.5.1.-, 2.5.1.17
Use Curated BLAST to search for 1.5.1.- or 2.5.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CHR3 at UniProt or InterPro
Protein Sequence (174 amino acids)
>Atu2495 flavoprotein oxidoreductase (Agrobacterium fabrum C58) MQMMSLEKEAAMETKTAEQRSLDYRNAMARLGAAVNIVTTDGAAGRAGFAATAVCSVSDN PPTLLVCLNRNASAYKVVKANGVICINTLAAHHEVLSTLFGGKTPAEERFAAGSWGVLET GAPVLEDALVSFDCRIREAHDGGTHDILICTVVDMKINAGDEALMYFNRRYRVL