Protein Info for Atu2495 in Agrobacterium fabrum C58

Annotation: flavoprotein oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR03615: pyrimidine utilization flavin reductase protein F" amino acids 20 to 174 (155 residues), 279.9 bits, see alignment E=2.8e-88 PF01613: Flavin_Reduct" amino acids 28 to 173 (146 residues), 139.5 bits, see alignment E=4.9e-45

Best Hits

Swiss-Prot: 100% identical to RUTF_AGRFC: FMN reductase (NADH) RutF (rutF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 100% identity to atu:Atu2495)

MetaCyc: 49% identical to cob(II)yrinate a,c-diamide reductase monomer (Brucella melitensis)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 2.5.1.17

Use Curated BLAST to search for 1.5.1.- or 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHR3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Atu2495 flavoprotein oxidoreductase (Agrobacterium fabrum C58)
MQMMSLEKEAAMETKTAEQRSLDYRNAMARLGAAVNIVTTDGAAGRAGFAATAVCSVSDN
PPTLLVCLNRNASAYKVVKANGVICINTLAAHHEVLSTLFGGKTPAEERFAAGSWGVLET
GAPVLEDALVSFDCRIREAHDGGTHDILICTVVDMKINAGDEALMYFNRRYRVL