Protein Info for Atu2494 in Agrobacterium fabrum C58

Annotation: NAD(P)+ transhydrogenase beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 477 (471 residues), 622.9 bits, see alignment E=1.9e-191

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 100% identity to atu:Atu2494)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHR4 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Atu2494 NAD(P)+ transhydrogenase beta chain (Agrobacterium fabrum C58)
MTIGIVSAAYVAAAVLFILSLGGLSGQESAKRAVWYGITGMGLAIVATVFGPEISKGVGQ
WLVVLLMLAGGSVLGYFVASRVQMTEMPQLVAALHSFVGLAAVFIGFNAHIEEAHVASLD
ETARSLLTGFSAILAHKTPVELAIMKVEVFLGVFIGAVTFTGSVVAFGKLAGKVDGKAKK
LPGGHLLNAGAAILSLVLLIMYCNGAGAWTLVLMTLAAFFIGYHLIMGIGGADMPVVVSM
LNSYSGWAAAAIGFTLGNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVILGGFGGTTG
PAMEIEGEQVAIDAEGVAAALNDADSVIIVPGYGMAVAQAQSAVSELTRKLRADGKTVRF
AIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFPSTDVVIVIGSNDIVNPAAQDDP
NSPIAGMPVLEVWKSKLVIVSKRGQGTGYSGIENPLFYKDNTRMFYGDAKKSINELLPLI
K