Protein Info for Atu2482 in Agrobacterium fabrum C58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 50 to 386 (337 residues), 294.6 bits, see alignment E=3.8e-92 PF25917: BSH_RND" amino acids 75 to 216 (142 residues), 80 bits, see alignment E=3.3e-26 PF25878: HH_AAEA_pHBA" amino acids 111 to 181 (71 residues), 37 bits, see alignment E=1.4e-12 PF25876: HH_MFP_RND" amino acids 116 to 184 (69 residues), 52.3 bits, see alignment E=1.9e-17 PF25944: Beta-barrel_RND" amino acids 224 to 310 (87 residues), 54 bits, see alignment E=6.5e-18 PF25954: Beta-barrel_RND_2" amino acids 255 to 311 (57 residues), 31.4 bits, see alignment E=6.1e-11 PF25967: RND-MFP_C" amino acids 318 to 377 (60 residues), 46.9 bits, see alignment E=7.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2482)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHS1 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Atu2482 HlyD family secretion protein (Agrobacterium fabrum C58)
MTLNTKRRALTGAGIGLAMSVAAGALFFDLPTSRNATAASTPAETPAIPVTVAKVESRDV
MRWEEFSGRLEAVDRVQIRSRVAGQIKAVHFREGALVKEGDPLFTIDPAPYQAAVAGAEG
QVASAEAKVSLAKTELDRGRRLSDNRTISQSDLDQRQSSFADAEAQLRAARAALTTAQLD
LGYTEIIAPVSGRVGRIEITAGNLVAAGSTSPALTTLVSVNPIYASFNASEGVVAKALAE
LPKTDGALPALEQIPVEIGTLSDEGTPIKGTLHLIDNQVDSASGTIGVRAIFDNPDGRLI
PGQFVRVRMGEPKPENRIVISDRAIGTDQDKRFVFVVDAENKVSYRQIKPGAPADGQRII
DSGLAAGDTIVVNGLQRIRPGATIAPQAEDKVAASQ