Protein Info for Atu2459 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (hemin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 108 to 138 (31 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 240 to 240 (1 residues), see Phobius details amino acids 242 to 243 (2 residues), see Phobius details amino acids 263 to 291 (29 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details PF01032: FecCD" amino acids 31 to 351 (321 residues), 296.1 bits, see alignment E=1.4e-92

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu2459)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHT5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Atu2459 ABC transporter, membrane spanning protein (hemin) (Agrobacterium fabrum C58)
MSLAVLSSTGGGVAGDRSRQGAVTLAVLVGILLFACGVSLVSGPTGVGVSELFAYLSGGA
DQLDARDRVILEAVRLPRTALGMLIGAGLGVSGAMMQGLFRNPLADPGIVGVTSGAALFA
VAAISLGEGSLAAVAVFFGPHFLPLMAFFGGLLNTWVLYVIATKDGATSTTTLILAGIAV
AAISGALTGLMIFVADDRALRDITFWSLGSLGGATPAKVLATLPFIIVVLAIIPFVARGL
DALILGDAAAFHMGIPVQRLKRVVILAVAAACGASVAAAGSIGFVGIVVPHLLRLAIGPS
HRFLLPASALGGAALLLLADSFARTVASPAELPIGVVTALIGAPVFLFLLLGRGGFSMRN
MP