Protein Info for Atu2456 in Agrobacterium fabrum C58

Annotation: lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 4 to 123 (120 residues), 46.1 bits, E=6.1e-16
• PF18029: Glyoxalase_6
  • amino acids 10 to 123 (114 residues), 26.6 bits, E=8.2e-10

Best Hits

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 100% identity to atu:Atu2456)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See A9CHT7 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Atu2456 lactoylglutathione lyase (Agrobacterium fabrum C58)
MAKLIHSMVRVLDEKRSVEFYKQAFGLEIAERAEFENFTLIYLSNAEGDFELELTVNRAR
EVPYALGDGYGHLAVSVADVDAEHQRFIGIGLTPGKMIEADHKGQPFAKYFFICDPDGYK
IEVLQRGDRFK