Protein Info for Atu2441 in Agrobacterium fabrum C58
Annotation: RNA methylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to atu:Atu2441)Predicted SEED Role
"Lipopolysaccharide core biosynthesis glycosyltransferase, group 2 family protein (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- Naphthalene and anthracene degradation
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Sphingolipid metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-, 2.4.1.-
Use Curated BLAST to search for 2.1.1.- or 2.4.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7CX19 at UniProt or InterPro
Protein Sequence (232 amino acids)
>Atu2441 RNA methylase (Agrobacterium fabrum C58) MLAAAHKAGGTFAAESILILRNRLSGVADILADFPDDVPVYVAEAPVLDGIVGFHLHRGI LALGRRVRDDGLEQMTAALPASSLVLVGCGISNHDNLGAMFRNAAAFYADAVLLDETCCD PLYRKALRVSVGSVLSVPYHRGGGAVEMLERLSEEGFAIWGLSPDGKTEIRDIPRSERMA LVIGTEGEGLPQSVLSRFQTARIAQSPQVDSLNAGTASGLALYQMAGVMGRV