Protein Info for Atu2425 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF13476: AAA_23" amino acids 33 to 68 (36 residues), 28 bits, see alignment 6.7e-10 PF00005: ABC_tran" amino acids 38 to 206 (169 residues), 102 bits, see alignment E=8.8e-33 PF12399: BCA_ABC_TP_C" amino acids 255 to 281 (27 residues), 41 bits, see alignment (E = 2.2e-14)

Best Hits

Swiss-Prot: 52% identical to LIVG_SALTY: High-affinity branched-chain amino acid transport ATP-binding protein LivG (livG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to atu:Atu2425)

MetaCyc: 51% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX34 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Atu2425 ABC transporter, nucleotide binding/ATPase protein (Agrobacterium fabrum C58)
MASGTMNMTSNTTGNTTGDTILKVEHLSMKFGGLMAINDFSFEAKRGEITALIGPNGAGK
TTVFNCITGFYKPTMGMITMRQQNGEAHLLERLPDFEITKKAKVARTFQNIRLFSGLTVL
ENLLVAQHNALMKASGYTILGLLGLPAYKRAVASSIEKAKYWLEKADLVDRADDPAGDLP
YGAQRRLEIARAMCTGPELLCLDEPAAGLNPKESLALNTLLRSIRDEGTSLLLIEHDMSV
VMQISDHVVVLEYGQKISDGSPDHVKNDPKVIAAYLGVEDDEVEDVIAEELDGGAA