Protein Info for Atu2417 in Agrobacterium fabrum C58

Annotation: putative gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 100% identity to atu:Atu2417)

MetaCyc: 40% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

L-idonate degradation (3/3 steps found)
D-sorbitol degradation II (1/1 steps found)
L-sorbose degradation (1/2 steps found)
superpathway of hexitol degradation (bacteria) (12/18 steps found)
ketogluconate metabolism (4/8 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.140 or 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHW0 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu2417 putative gluconate 5-dehydrogenase (Agrobacterium fabrum C58)
MGILQKFSLENRTAIITGSGRGLGFEIAKGFAEAGAHVWLTGRNAETLQQAVDTLRKAGG
KADYAAFDIADTAAGSALVRRIMDEAGHLDILVNNVGARDRRPLAEFTDDDVLELIRTDL
TSSISLSRDAAEAMNANGYGRIITITSILGHIVRPGDAIYPVAKQGLTGLMRAIAVEYGA
RGITSNAIAPGMFATETNAALAENPDMVAFAKLRVPLERWGRPDEIAGAALFLASDAASF
VNGHILTVDGGMSVRL