Protein Info for Atu2407 in Agrobacterium fabrum C58

Annotation: urease gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR00193: urease, gamma subunit" amino acids 1 to 100 (100 residues), 161 bits, see alignment E=3.8e-52 PF00547: Urease_gamma" amino acids 1 to 99 (99 residues), 156.9 bits, see alignment E=7.8e-51

Best Hits

Swiss-Prot: 100% identical to URE3_AGRFC: Urease subunit gamma (ureA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01430, urease subunit gamma [EC: 3.5.1.5] (inferred from 93% identity to rlg:Rleg_3312)

MetaCyc: 90% identical to urease gamma subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease gamma subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UCS6 at UniProt or InterPro

Protein Sequence (100 amino acids)

>Atu2407 urease gamma subunit (Agrobacterium fabrum C58)
MNLSPREKDKLLISMAAMVARRRLERGVKLNYPEAIALISDFVVEGARDGRAVADLMEAG
AHVISRDQVMDGIADMIHDVQVEATFPDGTKLVTVHEPIR