Protein Info for Atu2387 in Agrobacterium fabrum C58

Annotation: NTP pyrophosphohydrolase, MutT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00293: NUDIX" amino acids 12 to 116 (105 residues), 72.2 bits, see alignment E=4.5e-24 PF22327: Nudt16-like" amino acids 24 to 110 (87 residues), 30.8 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to atu:Atu2387)

Predicted SEED Role

"Nudix hydrolase family protein PA3470" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX66 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Atu2387 NTP pyrophosphohydrolase, MutT family (Agrobacterium fabrum C58)
MSSEPKREILIAAAILLNERRQMLVVRKRGTTQFMQPGGKIDPGETPEQALHRELAEEIG
LTLPKNAVRYEGIFREEAANEPGADVVAHAFSARLHSEVVPQAEIEEVRWLDLDHHPGVM
IARLTETQMLPLARAALTESDNQPR