Protein Info for Atu2373 in Agrobacterium fabrum C58

Annotation: UDP-hexose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 255 to 273 (19 residues), see Phobius details amino acids 291 to 306 (16 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 7 to 222 (216 residues), 36.9 bits, see alignment E=3.4e-13 PF00535: Glycos_transf_2" amino acids 10 to 175 (166 residues), 47.5 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2373)

Predicted SEED Role

"UDP-hexose transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHX5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu2373 UDP-hexose transferase (Agrobacterium fabrum C58)
MPEIMPEAVVCIPSFRRPEGLQKTLASLAAQKVDFPFAVVVVDNDGAGQQGLAVARAFFA
QNGMAGQALVEPTQGNCYAINTAFRTARQTYPSAEWFLMIDDDEAASPVWLGEMVSAAKS
FGVDIVGGPVNREFDAPASKAVLSHPLFGSIEAPTGLVEQIHGSGNCLISRRVFESLPKP
EFDVQFNFLGGGDMDFFTRCRKAGFKFAWNARAVIIEYVPESRMAPRWIMERSLRTGIIN
YSIDRARRPGLKGGLLLAAKNAVSLCLSLVRAVSAGLKTGALLPATHSPLMSIGRVMASL
GITLTPYKAPAKKT