Protein Info for Atu2356 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 192 to 226 (35 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 391 to 421 (31 residues), see Phobius details PF04932: Wzy_C" amino acids 217 to 361 (145 residues), 67.6 bits, see alignment E=5.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2356)

Predicted SEED Role

"exopolysaccharide production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CX92 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Atu2356 exopolysaccharide production protein (Agrobacterium fabrum C58)
MEKGREDPLMDAAHEEQARGYWRNTLFYVTFLYFTVGFSPYVSLSSTYEGSAMAAGSNLL
NQLIAIILLFSFVAFMAKERSFSLIFTPRLLMAAIFGWFVFTSIVGEAPMFSIRRLVMCA
IICVLAGGFLQLPRTERQFTTLLAGCVMIILFLCYFGVIVLPSRSIHQASDALEPLLAGN
WRGVFQHKNEAASVMAVLIILAIYLCRRWSFIGGLLVLLLSLIFLVKSGGKTVLGLMPIV
VSAGWFIVRWPSWRYTVVASLLLVFTVVTVGTTVDPVFAQMLTRMGVDASFTGRTDIWTV
AIDYIRQSPILGYGYQAFWRSDTLMSSFTENNSWATTAPASHSGYFDLLLAGGIPGLVLV
LMWICLLPLHYLGKMDSATRNSPLTRLYVGVWLYVLLYGFLETLFLLSSGFVWFFLLVAV
MGLHLQANASLVEDEAEPEPARNGKDAGRVKIPHPGLPVVRKRKLLAAQPTPSVESD