Protein Info for Atu2337 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 137 (128 residues), 56.5 bits, see alignment E=1.7e-19 amino acids 160 to 288 (129 residues), 50.6 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2337)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXA7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Atu2337 hypothetical protein (Agrobacterium fabrum C58)
MSLDRLAPAIFVFLWSTGWVTAKYAVYYTGPLTFLCLRYLLAGLLLWAICRFSGISWPKQ
RADVLRAILSGVFLHGIYLGMIWWAIGQGVPAAIGGIIAGLQPLMTAVAARFMIGERISP
LQRAGLLLGFAGIAIAVLPKVMATGALGMSVPLYAVAVNVLGMVSVTYGTLYQKKYVHGG
NIMAVATLQYVGALLVTVPFALLLEDGHVDWSLGLAATLGWSVGAISIGAVALLLYLIRR
GQVSRAASLIYLVPPLAAVEAAVLFGETLTPAMIAGTVLAVTGVYLANRKPAASVAVR