Protein Info for Atu2335 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details amino acids 31 to 33 (3 residues), see Phobius details transmembrane" amino acids 16 to 30 (15 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details PF07681: DoxX" amino acids 19 to 92 (74 residues), 53.3 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 48% identical to Y886_HAEIN: Uncharacterized protein HI_0886 (HI_0886) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2335)

Predicted SEED Role

"Mlr1652 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHZ6 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Atu2335 hypothetical protein (Agrobacterium fabrum C58)
MNMAILDNLSRYRPQALGALRIMTALLFISHGTQKLFGFPASQMDGSLPTMLLVAALLEA
VGGLLVLVGLFTRPVAFILSGQMAVAYFMAHGPKSFFPALNGGDAAILFCFIFLYLVFAG
AGAFSVDERRA